PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009604942.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 310aa    MW: 35539.9 Da    PI: 4.963
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009604942.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM78.81.2e-2471331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lp+GfrFhPtd el+  +L++ +++  l+ +  i+ ++i ++ePw++    +++ek  yf sk ++ +++ k+ +r++ +g+Wk +   k+++++
  XP_009604942.1   7 LPMGFRFHPTDVELI-TFLERYAHHGILPPDGDIEVAKIGDTEPWQIFGDSNSKEKTRYFVSKLKRFKNSTKKFSRTVGQGTWKGQSGGKPIKHR 100
                     799************.9**********999888**************87778888999**********99***********************98 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      k+  vg +++L + +g +++ ++ +W+m+ey l
  XP_009604942.1 101 sKNIIVGFRRSLKYKSGIKKE-QNDKWLMKEYIL 133
                     566679*********997777.79********76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.02E-263154IPR003441NAC domain
PROSITE profilePS5100528.3657154IPR003441NAC domain
PfamPF023651.5E-158132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MLPEAKLPMG FRFHPTDVEL ITFLERYAHH GILPPDGDIE VAKIGDTEPW QIFGDSNSKE  60
KTRYFVSKLK RFKNSTKKFS RTVGQGTWKG QSGGKPIKHR SKNIIVGFRR SLKYKSGIKK  120
EQNDKWLMKE YILAEDYFKE SNEDIIVLCK IKDKKMNEKK VDGNEITEEE FDELVTSLLG  180
CNQEKTLNWE GDTSGVLTVP ITDTGEQVGY TEALERNHHQ VTNNDNQLAL ANEAYDVMQI  240
NEANTTLITG TYEYQGFEVY GQGQTNYLAA GVEQNIDCQY ADYSNDWFLS MINFEELPEQ  300
DLGMQKAKQI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009604942.10.0PREDICTED: NAC domain-containing protein 2-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1523178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62380.14e-16NAC-domain protein 101